Glutathione S-transferase omega-1
Target information
- CovInDB Protein
- P78417
- Name
- Glutathione S-transferase omega-1
- Encoding Gene
- GSTO1
- Synonyms
-
- GSTO-1
- Glutathione S-transferase omega 1-1
- GSTO 1-1
- Glutathione-dependent dehydroascorbate reductase
- Monomethylarsonic acid reductase
- MMA(V) reductase
- S-(Phenacyl)glutathione reductase
- SPG-R
- Taxonomy
- Homo sapiens (Human)
- Description
-
Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Has also glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic and reduces monomethylarsonic acid (MMA) and dimethylarsonic acid.
- Sequence
-
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
- Active Site
-
Feature Key Position(s) Description Active site 32 Nucleophile Binding site 59 Glutathione Binding site 72 Glutathione; via amide nitrogen and carbonyl oxygen - Structure
-
Check covalent ligand-protein complexes.
PDB: 6PNO
Show SurfaceSite View - Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|