Macrophage migration inhibitory factor
Target information
- CovInDB Protein
- P14174
- Name
- Macrophage migration inhibitory factor
- Encoding Gene
- MIF
- Synonyms
-
- MIF
- Glycosylation-inhibiting factor
- GIF
- L-dopachrome isomerase
- L-dopachrome tautomerase
- Phenylpyruvate tautomerase
- Taxonomy
- Homo sapiens (Human)
- Description
-
Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity.
- Sequence
-
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
- Active Site
-
Feature Key Position(s) Description Active site 2 Proton acceptor; via imino nitrogen Binding site 33 Substrate Binding site 65 Substrate; via amide nitrogen Binding site 98 Substrate - Structure
-
Check covalent ligand-protein complexes.
PDB: 5J7P
Show SurfaceSite View - Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|