Glutathione S-transferase P
Target information
- CovInDB Protein
- P09211
- Name
- Glutathione S-transferase P
- Encoding Gene
- GSTP1
- Synonyms
-
- GST class-pi
- GSTP1-1
- Taxonomy
- Homo sapiens (Human)
- Description
-
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2) (PubMed:9084911).
Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276).
Negatively regulates CDK5 activity via p25/p35 translocation to prevent neurodegeneration - Sequence
-
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
- Active Site
-
Feature Key Position(s) Description Binding site 14 glutathione Binding site 39 glutathione Binding site 45 glutathione Binding site 52-53 glutathione Binding site 65-66 glutathione Binding site 8 glutathione - Structure
-
Check covalent ligand-protein complexes.
PDB: 5X79
Show SurfaceSite View - Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|