Protease 3C
Target information
- CovInDB Protein
- P03303
- Name
- Protease 3C
- Encoding Gene
- Not Available
- Synonyms
-
- Picornain 3C
- P3C
- Taxonomy
- Human rhinovirus 14
- Description
-
Major viral protease that mediates proteolytic processing of the polyprotein (By similarity). Cleaves host EIF5B, contributing to host translation shutoff (By similarity). Cleaves also host PABPC1, contributing to host translation shutoff
- Sequence
-
GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ
- Active Site
-
Feature Key Position(s) Description Active site 147 For protease 3C activity Active site 40 For protease 3C activity Active site 71 For protease 3C activity - Structure
-
PDB: 2B0F
Show SurfaceSite View - Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|