Cathepsin L-like protein
Target information
- CovInDB Protein
- C0J418
- Name
- Cathepsin L-like protein
- Encoding Gene
- Not Available
- Synonyms
-
- Not Available
- Taxonomy
- Trypanosoma brucei rhodesiense
- Description
-
Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
- Sequence
-
LCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVSCDTIDSGCNGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDHVDLPQDEDAIAAYLAENGPLAIAVDATSFMDYNGGILTSCTSEQLDHGVLLVGYNDNSNPPYWIIKN
- Active Site
-
Feature Key Position(s) Description None None None - Structure
- Not Available
- Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|